PSBY-1 and -2 are manganese-binding polypeptides with L-arginine metabolizing enzyme activity. They are a component of the core of photosystem II. They have also a minor catalase-like activity since they cause evolution of oxygen from hydrogen peroxide in a reaction stimulated by manganese.

Belongs to the PsbY family.

199 amino acids

MAATMATTMAVLNTKCLTLNTNKTTSTSPKPTSKPISLSPLGLSNSKLPMGLSPIITAPAIAGAVFATLGSVDPAFAVQQLADIAAEAGTSDNRGLALLLPIIPALGWVLFNILQPALNQINKMRNEKKAFIVGLGLSGLATSGLLLATPEAQAASEEIARGSDNRGTLLLLVVLPAIGWVLFNILQPALNQLNKMRSQ

20.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PSBY using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here