May be a component of the oxygen-evolving complex.

105 amino acids

MASITMTTSFLSTTNLTKGSPRITQRRLVVANAAKGAQVESVQMSGERKTEGNNGRREMMFAAAAAAICSVAGVATAEPKRGSAEAKKAYAPVCVTMPTARICRN

11 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PSBT using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here