Stabilizes the structure of photosystem II oxygen-evolving complex (OEC), the ion environment of oxygen evolution and protects the OEC against heat-induced inactivation.

Belongs to the PsbU family.

142 amino acids

MKKIGLLLTIFSLCLGCLGLVPSDKAHAGNLNLTTWPSASILAVESRTVNNADKKLGEIGEKLDLNNSPLRSFRKYRGMFPTIAAQIVDNAPYEKVEDVLEMPGLTEEQKKLLEANLKNFTVTKTADVYNEGDYRLNTGSYD

15.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make psbU using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here