Stabilizes the interaction between PsaC and the PSI core, assists the docking of the ferredoxin to PSI and interacts with ferredoxin-NADP oxidoreductase.

Belongs to the PsaE family.

75 amino acids

MAIARGDKVRILRPESYWFNEVGTVASVDQSGIKYPVVVRFEKVNYNGFSGSDGGVNTNNFAEAELQVVAAAAKK

8.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make psaE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here