Protein expression services for regA | Photosynthetic apparatus regulatory protein RegA
Description
Member of the two-component regulatory system RegB/RegA. Involved in transactivating anaerobic expression of the photosynthetic apparatus. It is a transcriptional regulator that is responsible for activating expression of the puf, puh, and puc operons in response to a decrease in oxygen tension (By similarity).
Species
Rhodovulum sulfidophilum
Length
183 amino acids
Sequence
MAEQEYEIGEDPSLLIVDDDEPFLRRLARAMEKRGFQPEMAETVAAGKAIASARPPAYAVVDLRLEDGTGLDVVETLREKRPDAKIVVLTGYGAIATAVAAVKVGATDYLSKPADANDVTAALLSNGEALPPPPENPMSADRVRWEHIQRVYEQCDRNVSETARRLNMHRRTLQRILAKRSPR
Mass
20.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make regA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here