Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates (By similarity).

Belongs to the HAD-like hydrolase superfamily. SerB family.

270 amino acids

MSGSVLSLARPAAATNGHNLLTKQLNCNGNGTTGGAAKTTVASAITPPKQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAEGKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQPTSRSGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPPANYFIGFGGNVVRPEVYRRAQYYVTDFEQLMGQ

29.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aay using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here