Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. SerC subfamily.

363 amino acids

MSRIYNFCAGPAMLPAAVMQKAQQELLDWNGLGVSVMEISHRSKEFIALAEQAEVNLRQLMNIPNHYHVLFMHGGGRSQFSNVVNNFLGDHGRALYLVSGQWSQSAVEEAQKLAGEAQIDALNIVTKADGLNQVTLPDLHSIKKDYRYVHYCTNETVDGIEIFDELDSPWPIVADLSSTIMSREIDVSRYGLIYAGAQKNIGPSGLSIVIVRDDMLKLASLPQSSVMDYRIAAENGSMFNTPPTFAWYLAAEVFNWLKGLGGVEVIAQVNQQKAQLLYACIDDNSFYRNGVAKQNRSQMNVTFQLADDSLDSRFLAEAERAGLVALKGHRIVGGMRASLYNAMPLEGVQALVTFMSEFATKHS

40.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make serC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here