Modifies the subcellular distribution of heterogeneous nuclear ribonucleoprotein K (HNRNPK) and may contribute to modulate HNRNPK functions related to processing and export of mRNAs during ASFV infection.

Belongs to the asfivirus phosphoprotein p30 family.

200 amino acids

MDFILNISVKMEVIFKTDLRSSSQVVFHAGSLYTWFSIEIINSGRIVTTAIKTLLNTVKYDIVRSARVYAGQGYTEQQAQEEWNMILHVLFEEETESSASLESIHEKNDHEKNDHEIDECTSSFETLFEQEPSSTETPKNAKLYALAQKTVQHIEQYGKAPDFNKIIRAHNFIQTIHGTPLKEEEKEEVRLMVIKLLKKK

23.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mal-101 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here