Description
Phospholipase that may play a role in phospholipids remodeling. May selectively cleave myristate (C14)-containing phosphatidylcholines through its predominant phospholipase 1 activity, cleaving preferentially acyl groups in sn1 position. In parallel, may have a minor phospholipase 2 activity acting on acyl groups in position sn2. In addition to (C14)-containing phosphatidylcholines, may also act on other medium-chain-containing and oxidatively truncated phospholipids.
Family
Belongs to the AB hydrolase superfamily. AB hydrolase 4 family.
Sequence
MQRLAMDLRMLSRELSHYLEHQVRVGFFGSGVGFSLILGFSVAYACYYLSSIAKKPQLVTGGESFSRFLQDHCPVVTETYYPTVWCWESRGQTLLRPFITSKPLVQYRNELIKTADGGQISLDWFDNDNSKHYMDASTRPTVLLLPGLTGTSKESYILHMIHLSEELGYRYVVFNNRGVAGENLLTPRTYCCSNTEDLETVIHHVHSLYPSAPFLAAGVSMGGMLLLNYLGKIGPKTPLKAAATFSVGWNTFACSESLEKPLNWLLFNYYLTTCLQSSVNKHRHMFVKQIDVDHVMKAKSIREFDKRFTSVMFGYRTIDDYYTDASPNRRLKSVGIPVLCLNSVDDVFSPSHAIPIETAKQNPNVALVLTSYGGHIGFLEGIWPRQSTYMDRVFKQFVQAMIEHGHELSSM
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service