Phospholipase that may play a role in phospholipids remodeling. May selectively cleave myristate (C14)-containing phosphatidylcholines through its predominant phospholipase 1 activity, cleaving preferentially acyl groups in sn1 position. In parallel, may have a minor phospholipase 2 activity acting on acyl groups in position sn2. In addition to (C14)-containing phosphatidylcholines, may also act on other medium-chain-containing and oxidatively truncated phospholipids.

Belongs to the AB hydrolase superfamily. AB hydrolase 4 family.

411 amino acids

MQRLAMDLRMLSRELSHYLEHQVRVGFFGSGVGFSLILGFSVAYACYYLSSIAKKPQLVTGGESFSRFLQDHCPVVTETYYPTVWCWESRGQTLLRPFITSKPLVQYRNELIKTADGGQISLDWFDNDNSKHYMDASTRPTVLLLPGLTGTSKESYILHMIHLSEELGYRYVVFNNRGVAGENLLTPRTYCCSNTEDLETVIHHVHSLYPSAPFLAAGVSMGGMLLLNYLGKIGPKTPLKAAATFSVGWNTFACSESLEKPLNWLLFNYYLTTCLQSSVNKHRHMFVKQIDVDHVMKAKSIREFDKRFTSVMFGYRTIDDYYTDASPNRRLKSVGIPVLCLNSVDDVFSPSHAIPIETAKQNPNVALVLTSYGGHIGFLEGIWPRQSTYMDRVFKQFVQAMIEHGHELSSM

46.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ABHD3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here