Description
Phosphatidylserine (PS) lipase that mediates the hydrolysis of phosphatidylserine to generate lysophosphatidylserine (LPS). LPS constitutes a class of signaling lipids that regulates immunological and neurological processes (By similarity). Has no activity towards diacylglycerol, triacylglycerol or lysophosphatidylserine lipase (By similarity). Also has monoacylglycerol lipase activity, with preference for 1-(9Z,12Z-octadecadienoyl)-glycerol (1-LG) and 2-glyceryl-15-deoxy-Delta(12,14)-prostaglandin J2 (15d-PGJ(2)-G) (By similarity).
Family
Belongs to the AB hydrolase superfamily. ABHD16 family.
Sequence
MAKLLSCVLGPRLYKIYRERDTDRAATSVPETPTAVPAASSSSWDSYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLVLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSAENKRQLANYNFDFRSWPVDFHWEEPSSRKGSRGGPSRRGVALLRPEPLHRGTADTFLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIVIYAWSIGGFTATWAAMSYPDISAVILDASFDDLVPLALKVMPDSWRALVTRTVRQHLNLNNAEQLCRFQGPVLLVRRTKDEIITTTVPEDIMSNRGNDLLLKLLQFRYPRVMTEEGLRAVRQWLEASSQLEEASIYSRWEVDEDWCVSVLRSYQAEHGPDFPWSVGEDMSVDGRRQLALFLARKHLHNFEATHCTPLPAQHFQMPWCL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service