Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.

Belongs to the PIGP family.

137 amino acids

MLSLNQEVHGPKTSEVYGFVGSISIVVATVIFLIWGYVPDKFLESIGIYYYPSKYWAMAMPMYSMVTLLVALVFYIGLNFMSTSKPTSLNTLFDDYSREDVNFLPLMKNGEDRPIDPISDIDITRINDLMFDSHLAK

15.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make At1g61280 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here