Description
Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking (By similarity).
Family
Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.
Sequence
MAEACEPTRPSEDEDEEREPLLPRVAWAQPRRVAPGSAVRMQADEGADVLREPATDEPPAVSGEGSISASLSTELDRTRTTSSETNTFLEDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLLPNQGYLSEAGAYLVDVKLNLGIVPKTKVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKVGSFQLFVKDYKEAEYWLRRFEAEPLPENIRKQFQSQFEKLVILDYIIRNTDRGNDNWLVKYDEMKYAKKIESEESNWIDNKQLLIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFSEETRNLILPYISDMNFVQDLCEDLYELFKTDKGFDRAAFENQMSVMRGQILNLTQALRDGKSPMQLAQMPCVIVECSKSGSQGRVVHLGSSFTQTVHCRKPFFSSW
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service