Catalyzes the second two steps of the methylation pathway of phosphatidylcholine biosynthesis, the SAM-dependent methylation of phosphatidylmonomethylethanolamine (PMME) to phosphatidyldimethylethanolamine (PDME) and of PDME to phosphatidylcholine (PC).

Belongs to the class VI-like SAM-binding methyltransferase superfamily. PEMT/PEM2 methyltransferase family.

164 amino acids

MGLLAAIGVLLPFPFYWWLWTNAQSWVNLCGRERDPSTVMARVSHVLKAAQLLSLFSVASLSWPPPLYFWPLMAFGQFLNFRVYQLLGEAGTYYGVRFGKNIPWVTEFPFGVIRDPQYVGSIMSLLACLSWVPFQYILLWSLGYVFMMFLESKEDPNARAKSIS

18.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PLMT using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here