Colony queen number, a major feature of social organization, is associated with worker genotype for Gp-9. Colonies are headed by either a single reproductive queen (monogyne form) or multiple queens (polygyne form). Differences in worker Gp-9 genotypes between social forms may cause differences in workers' abilities to recognize queens and regulate their numbers (By similarity).

Belongs to the PBP/GOBP family.

153 amino acids

MKTFVLHIFIFALVAFASASRDSAKKIGSQYDNYETCLTEHGLTEDDIFSIGEVSSGQHKTNHEDTELHKNGCVMQCMLEKDGLMSGADYDEEKMREDYIKETGAQPGDQRIEALNACMQETKDMEDKCDKSLILVACVLAAEAVLADSSEGA

16.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Gp-9 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here