Involved in the non-oxidative decarboxylation and detoxification of phenolic derivatives under both aerobic and anaerobic conditions. Phenolic acid decarboxylase that catalyzes the reversible decarboxylation of 4-hydroxybenzoate and vanillate.

Belongs to the UbiD family. YclC subfamily.

475 amino acids

MAFDDLRSFLQALDDHGQLLKISEEVNAEPDLAAAANATGRIGDGAPALWFDNIRGFTDARVAMNTIGSWQNHAISLGLPPNTPVKKQIDEFIRRWDNFPIAPERRANPAWAQNTVDGDEINLFDILPLFRLNDGDGGFYLDKACVVSRDPLDPDNFGKQNVGIYRMEVKGKRKLGLQPVPMHDIALHLHKAEERGEDLPIAITLGNDPIITLMGATPLKYDQSEYEMAGALRESPYPIATAPLTGFDVPWGSEVILEGVIESRKREIEGPFGEFTGHYSGGRNMTVVRIDKVSYRTRPIFESLYLGMPWTEIDYLMGPATCVPLYQQLKAEFPEVQAVNAMYTHGLLAIISTKKRYGGFARAVGLRAMTTPHGLGYVKMVIMVDEDVDPFNLPQVMWALSSKVNPAGDLVQLPNMSVLELDPGSSPAGITDKLIIDATTPVAPDNRGHYSQPVVDLPETKAWAEKLTAMLAARK

52.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make edcC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here