Protein expression services for phtx | Phaiodotoxin
Description
Sodium channel (Nav) specific neurotoxin. Causes impairment of movement and mild paralysis in crickets at a dose of 0.5 ug per animal. A dose of 0.8 ug per cricket causes clear flaccid paralysis. A dose of 1.0 ug per cricket causes death within 2 hours.
Family
Belongs to the long (4 C-C) scorpion toxin superfamily. Sodium channel inhibitor family.
Species
Anuroctonus phaiodactylus
Length
90 amino acids
Sequence
MKTIPLLFLLFIYFECDGKFIRHKDESFYECGQLIGYQQYCVDACQAHGSKEKGYCKGMAPFGLPGGCYCPKLPSNRVKMCFGALESKCA
Mass
10.1 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make phtx using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here