Part of an ABC transporter complex involved in ferric-petrobactin uptake. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily.

334 amino acids

MISRVENISQPQFYNHNKIWTKPFIIAIIVVIILGIISLFTGVYDIRGQEDGMEMFFITRVPRTVALMLTGAAMAMAGLVMQLITQNRFVEPTTTGTIEWSSLGLLFVYLLFPAPTLVQRMTGAIIFSFIGTMIFFLFLRRVKLRSSLIVPIIGLMLGAVISAVSTFLGLLFQMTQSIETWFVGSFANIQVGRYEYLWLIVIVTLLIFMYANRLTLAGLGEDVATSLGVNYNRIVLFGTALISVAVGIVAAVIGNLPFLGLIVPNIVSMFRGDDLRSNLPWVCVIGMGTITACDIISRTIIKPFELPVSLILASVGAVVFITILLRKRKPRRLR

37 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fatD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here