Enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids. Protects the cells from the increase of the harmful xenobiotic fatty acids incorporated from their diets and optimizes cellular lipid composition for proper development.

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

441 amino acids

MALNFKDKVVIVTGAGGGIGKVYALEFAKRGAKVVVNDLGGSHTGQGSSSKAADKVVEEIKAAGGTAVANYDSVEDGEKIVQTAMDSFGGVDILINNAGILRDVSFGKMTDGDWDLVYRVHAKGAYKLSRAAWNHMREKNFGRIIMTSSAAGLYGNFGQANYGSMKMALVGLSNTLAQEGKSKNIHCNTIAPIAASRLTESVMPPEILEQMKPDYIVPLVLYLCHQDTTETGGVFEVGAGWVSKVRLQRSAGVYMKDLTPEKIKDNWAQIESFDNPSYPTSASESVSGILAAVNSKPADGESVLVRPPKVAVPKALAATPSGSVVVDGYNASKIFTTIQGNIGAKGAELVKKINGIYLINIKKGTNTQAWALDLKNGSGSIVVGAGSTKPNVTITVSDEDFVDIMTGKLNAQSAFTKGKLKISGNMGLATKLGALMQGSKL

46.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mfeA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here