Involved in redox regulation of the cell. Acts as an antioxidant. Inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation. May affect bone resorption and help to maintain bone mass (By similarity).

Belongs to the peroxiredoxin-like PRXL2 family. PRXL2A subfamily.

224 amino acids

MSFLPDFGIFTMGMWSVGLGAVGAAITGIVLANTDLFLSKPEKATLEFLEAIELKTLGSEPRTFKASELWKKNGAVIMAVRRPGUFLCREEASELSSLKPQLSKLGVPLYAVVKEKIGTEVEDFQHYFQGEIFLDEKRSFYGPRKRKMMLSGFFRIGVWQNFFRAWKNGYSGNLEGEGFTLGGVYVIGAGRQGILLEHREKEFGDKVSLPSVLEAAEKIKPQAS

24.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PRXL2A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here