Description
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (PubMed:19766572).
Family
Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily.
Sequence
MSSGKAFIGKPAPDFTATAVMPDGQFKDIKLSDYRGKYVVFFFYPLDFTFVCPTEIIAYSDRADEFKKINCEIIGASVDSHFCHLAWINTPKKQGGLGTMKIPLVSDTKRVIAKDYGVLKEDEGIAYRGLFIIDEKGILRQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service