Rescues stalled ribosomes (PubMed:21418110, PubMed:21051357, PubMed:22922063). Can hydrolyze peptidyl-tRNA on ribosomes stalled by both non-stop mRNAs and mRNAs that contain rare codon clusters (PubMed:21051357) or ribosomes stalled in the middle of mRNA (PubMed:22922063). First identified as a complementary ribosome rescue system when the stalled ribosome cannot be rescued by the SsrA(tmRNA)-SmpB quality control system or the alternative ribosome-rescue factor A (arfA) (PubMed:21418110).

Belongs to the prokaryotic/mitochondrial release factor family.

140 amino acids

MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTEKKARRPTRPTRASKERRLASKAQKSSVKAMRGKVRSGRE

15.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make arfB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here