Protein expression services for msrA | Peptide methionine sulfoxide reductase MsrA
Description
Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).
Family
Belongs to the MsrA Met sulfoxide reductase family.
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Length
206 amino acids
Sequence
MGWHPLGEHGAPHNSSMTQQTNSQGTQPGAAQEQAIFAGGCFWCTEAVMQDLRGVQKVESGYIGGTVPNPDYRSVCGGQTGHAEAVRVTFDPNQISYRDLLGLFFATHDPTSLNRQGADVGTQYRSALFPLTQEQEQTAREMIEQLGTEDVFGRPIVTSIEPASTFYVAEDYHQNYYKNNPGQGYCMAVISPKVAKLRQYYGDKLR
Mass
22.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make msrA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here