Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

217 amino acids

MFLIDMFNKKTILPDAATALPGREEEIPTATTHFVSGRPLQGPYPEGMKKVLFGMGCFWGAERLLWEIPGVYVTAAGYSGGLTPNPTYQETTTGLTGHTEVVLVVYDPAKVSLQRLLKTFFEEHDPTQGMRQGNDVGTTYRSAIYVYDEEQLAEANAARNAFQKALRVYNHDREITTEIAKAGPFYFAEDYHQQYLAKNPDGYCGLRGTGVSCPIGA

24 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make msrA1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here