Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity).

Belongs to the MsrB Met sulfoxide reductase family.

153 amino acids

MNTSPKMEMEMKMETKAAPEAGMIKKSNEEWRTVLSPEQFKILREKSIEKRGSGEYVKLFEEGIYCCVGCGNPVYKSTTKFDSGCGWPAFFDAIPGAINRTEERAGLRYEITCTKCDGHLGHVLKNEGFPTPTDERHCVNSVALKFSSAITSQ

17.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MSRB6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here