About Products Protein Database Contact

Protein expression services for MSRB2 | Peptide methionine sulfoxide reductase B2, chloroplastic

Description
Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Specifically reduces the MetSO R-enantiomer. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. May play an essential function in association with MSRB1 in maintaining vegetative growth during environmental constraints, through the preservation of photosynthetic antennae. MSRB1 and MSRB2 account for most of the leaf peptide MSR capacity.
Family
Belongs to the MsrB Met sulfoxide reductase family.
Species
Arabidopsis thaliana
Length
202 amino acids
Sequence
MAFNIITPGRVYSATSLTFVSTIKAAFVKPPLASPSRRNLLRFSSSPLSFPSLRRGFHGGRIVAMGSSAPESVNKPEEEWRAILSPEQFRILRQKGTEYPGTGEYNKVFDDGIYCCAGCGTPLYKSTTKFDSGCGWPAFFDGLPGAITRTPDPDGRRIEITCAACGGHLGHVFKGEGFPTPTDERHCVNSISLKFTPENPTL
Mass
22 kDa
Simulated SDS-PAGE
Western blot of MSRB2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make MSRB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here