Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.

Belongs to the peptidase A1 family.

387 amino acids

MKWLLLLGLVALAEGLIHKVALVKKKSLRQSLWENGLLEDFLKTHSLNPASKYFPTEATTLSANQPLVNYMDMEYFGTISIGTPPQEFTVIFDTGSSNLWVPSIYCSSPACSNHNRFDPQKSSTFKPTSQTVSIAYGTGSMTGVLGYDTVQVAGIADTNQIFGLSQSEPGSFLYYSPFDGILGLAYPSISSSGATPVFDNMWNQGLVSQDLFSVYLSSNDQSGSVVMFGGIDSSYYTGSLNWVPLSSEGYWQITVDSITMNGQSIACNGGCQAIVDTGTSLLSGPTNAIANIQSKIGASQNSQGQMAVSCSSIKNLPDIVFTINGIQYPLPASAYILQSQEGCSSGFQGMDIPTSSGELWILGDVFIRQYFTVFDRANNQVGLAPVA

41.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PGA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here