In association with P2 and trimeric P5, forms the spike complexes located at the 5-fold vertices of the capsid. Essential for viral infectivity.

126 amino acids

MNVNNPNQMTVTPVYNGCDSGEGPQSVRGYFDAVAGENVKYDLTYLADTQGFTGVQCIYIDNAENDGAFEIDVEETGQRIKCPAGKQGYFPLLVPGRAKFVARHLGSGKKSVPLFFLNFTIAQGVW

13.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make XXXI using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here