Protein expression services for kdgR | Pectin degradation repressor protein KdgR
Description
Transcriptional repressor of genes involved in pectinolysis and in pectinase secretion. Controls all the genes involved in pectin catabolism, including the pel genes encoding pectate lyases, KdgT which encodes the 2-keto-3-deoxygluconate transport system and KdgK which encodes the kdg kinase.
Species
Dickeya chrysanthemi
Length
305 amino acids
Sequence
MIFNRSVTYSNARLPYSKRSLYTKTRVLFFLKQKILSRVTTKMAIADLDKQPDSVSSVLKVFGILQALGEEREIGITELSQRVMMSKSTVYRFLQTMKSLGYVAQEGESEKYSLTLKLFELGAKALQNVDLIRSADIQMRELSALTRETIHLGALDEDSIVYIHKIDSMYNLRMYSRIGRRNPLHSTAIGKVLLAWRDREEVKEILSQVEFKRTTVHTIGSTEELLPQLDLVRQQGYGEDNEEQEEGLRCIAVPVFDRFGVVIAGLSISFPTIRFSEDNKHEYVAMLHTAARNISDQMGYHDYPF
Mass
35 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make kdgR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here