Hydrolyzes acetyl esters in homogalacturonan regions of pectin. In type I primary cell wall, galacturonic acid residues of pectin can be acetylated at the O-2 and O-3 positions. Decreasing the degree of acetylation of pectin gels in vitro alters their physical properties.

Belongs to the pectinacetylesterase family.

397 amino acids

MFKLKQWLIYLVCSLVIMNTEGLFVNITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGVQYIKTYFEDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRTTIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVFTPLDAPPI

44.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PAE8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here