Paxilline synthesis protein A: Part of the gene cluster that mediates the biosynthesis of paxilline, a mycotoxin that acts as an inhibitor of mammalian maxi-K channels (PubMed:11169115, PubMed:23949005). PaxG, the geranylgeranyl diphosphate (GGPP) synthase is proposed to catalyze the first step in paxilline biosynthesis (PubMed:23949005). Condensation of indole-3-glycerol phosphate with GGPP by paxC then forms 3-geranylgeranylindole (3-GGI), followed by epoxidation and cyclization of this intermediate (by paxM and paxB) to form paspaline (PubMed:23949005). Paspaline is subsequently converted to 13-desoxypaxilline by paxP, the latter being then converted to paxilline by paxQ (PubMed:23949005). Finally paxilline can be mono- and di-prenylated by paxD (PubMed:23949005). The exact role of paxA in paxilline biosynthesis is still unknown (PubMed:23949005).

Belongs to the paxA family.

356 amino acids

MTSITTSVLVLHSLLAANFKYYQSFQNGFIDMLSAMADSNSVSGLPGQLCREYTGIRPLDTFLTSCTVFFWPTFQGEIPGLSLYGIAFASAMIPMWLIIVIDVHRRRQPFGALVELIAFAGPLIQCIGPGLVMPLLLARIHTPSRDSKSASQFDYRTFIPSMIIGYILPLLLASLPAPLILSYHNKQQFIAIWQGWPLYSSVLMWAFRRRSGHVHCSRHKGLKHACIFALACSSAGHLVLLSLTWLWSLSYWGYIQSAPWNEPPLASLEAGVLRFLQWDYTLSASATLSWAIAFRHEVVQQKSLRISLLSLLRCLIGIVFLGPCSMVALLYWQTCSLQEEAGQKAPAKDKQLDQEI

39.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make paxA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here