Palmitoyltransferase specific for VAC8. Palmitoylates VAC8 at one or more of its N-terminal cysteine residues, which is required for its proper membrane localization (By similarity).

Belongs to the DHHC palmitoyltransferase family. PFA3 subfamily.

405 amino acids

MLISHPRIMIRHAPWVTSIETFCCSLATLFPKVFYTSVLTWSVYALIVHGCYDTLMTTQETSIFAIAIGLIGLTLYILCLYTYFKVLRAGPGSPSDFEELRIRNILSLSKPKYNSANPYDTNDNMATSASLLANAEGVDEIESIESEQPPSEYMTLHMLKSNNSSYRYCTKCSVWKPDRCHHCSTCNRCVLRMDHHCPWFAMCVGFYNHKFFAQFLMYLTAYSGFDFVVSLSILWKFFADEKYNDHYLSLNLVFLFVLSLAFFITVGGFSAFSLYLVFRNKTTIEFQENRWNFKNDKNGKSFQYEFDGSGKKKKLGNIFDLGCGRNWRSIMGPSWYYWLLPVTVTNKSIDARLENGINFEIDQDVYDRWCYNAQLQDQLNQQLADYKNRIRMEREANQTTDTNPF

47.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PFA3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here