About Products Protein Database Contact

Protein expression services for mtlA | PTS system mannitol-specific EIICB component

Description
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II CmtAB PTS system is involved in D-mannitol transport.
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Length
488 amino acids
Sequence
MRKKLAKVKVHIQSLDSLLSSMTMPIIGIFIAWGLLASFFIPSGWTPDKNLALMVGIGIQYVIPTIIXFFGGKKIYEIRGGVIAVIIAIAVIAAGQTEAFTKIVGQKSVMFLGVMIFGPIAALILKHTEKFWIHRIKSGFEMLVNNFYLGFLGFALIFPSFYLSIYLIGYIQLGLKLLVEIMQQYKLYPIAAIVIEPAKVLFLNNAINHGVLTPLGLQQVRDSGKSILFLLESNPGPGLGLLVAFLIFFFKRDKKLSSNAASSSPIHLFGGIHEVYFPFVLLKPVLILATIAVGVVGNGILQIFNAGTIAPVSPGSVIAGFLQINKTPLDVAGYALALVLSAVTSLLISLLLLSLTRKKQLKTLQEAQAQVAEMKQTPAKKPRQKDTPAIATKIDFSQVTFVCDAGMGSSTMGAAIFRKELKNQNIEDITVINKAIVDLKDEKVIITISQLYDRVKAKRADATIYTINQFLDKQGYLTIIEKIKNEKN
Mass
53.4 kDa
Simulated SDS-PAGE
Western blot of mtlA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mtlA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here