About Products Protein Database Contact

Protein expression services for gatC | PTS system galactitol-specific EIIC component

Description
The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The enzyme II complex composed of GatA, GatB and GatC is involved in galactitol transport.
Species
Escherichia coli (strain K12)
Length
451 amino acids
Sequence
MFSEVMRYILDLGPTVMLPIVIIIFSKILGMKAGDCFKAGLHIGIGFVGIGLVIGLMLDSIGPAAKAMAENFDLNLHVVDVGWPGSSPMTWASQIALVAIPIAILVNVAMLLTRMTRVVNVDIWNIWHMTFTGALLHLATGSWMIGMAGVVIHAAFVYKLGDWFARDTRNFFELEGIAIPHGTSAYMGPIAVLVDAIIEKIPGVNRIKFSADDIQRKFGPFGEPVTVGFVMGLIIGILAGYDVKGVLQLAVKTAAVMLLMPRVIKPIMDGLTPIAKQARSRLQAKFGGQEFLIGLDPALLLGHTAVVSASLIFIPLTILIAVCVPGNQVLPFGDLATIGFFVAMAVAVHRGNLFRTLISGVIIMSITLWIATQTIGLHTQLAANAGALKAGGMVASMDQGGSPITWLLIQVFSPQNIPGFIIIGAIYLTGIFMTWRRARGFIKQEKVVLAE
Mass
48.4 kDa
Simulated SDS-PAGE
Western blot of gatC recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make gatC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here