Involved in the transport and simultaneous phosphorylation at O-6 of the glucosyl moiety of sucrose and its five linkage-isomeric alpha-D-glucosyl-D-fructoses. Can also transport maltose, isomaltose and maltitol, phosphorylating at O-6 of their non-reducing glucose portion.

540 amino acids

MLSQIQRFGGAMFTPVLLFPFAGIVVGIAIMLRNPMFVGEALTAPDSLFAQIVHIIEEGGWTVFRNMPLIFAVGLPIGLAKQAQGRACLAVLVSFLTWNYFINAMGMTWGHFFGVDFSAEPTAGSGLTMIAGIKTLDTSIIGAIVISGLVTALHNRYFDKPLPVFLGIFQGSSFVVIVAFLAMIPCAWLTLLGWPKVQLGIESLQAFLRSAGALGVWVYIFLERILIPTGLHHFVYGPFIFGPAVVEGGLQVYWAEHLQAFSQSTEPLKTLFPEGGFALHGNSKVFGSVGIALALYFTAAPENRVKVAGLLIPATLTAMLVGITEPLEFTFLFISPLLFAVHAVLAATMATVMYICGVVGNFGGGLLDQFLPQNWIPMFHHHASMMFIQIGIGLCFTALYFVVFRTLILRLNLKTPGREESEIKLYSKADYQAARGKTTAAAAPETRLGQAAGFLQALGGADNIESINNCATRLRIALVDMAKTQSDDVFKALGAHGVVRRGNGIQVIVGLHVPQVRDQLENLMKDSLSTEHTTMTEAVS

58.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aglA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here