Protein expression services for SSP0594 | PTS system EIIBC component SSP0594
Description
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane.
Species
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Length
479 amino acids
Sequence
MTKEQILAEHIIDAVGGIDNMDNIINCMTRVRIKVLDEDKIDYEQLKSIKGVMGVVKDDRVQVVVGPGTVNKVASHMSELSGAPLGETIKHKSKDYRANAEAQAQANKSEFQSKQKRGKFNKLLKTIANIFIPLIPAFIGAGLIGGIAAVLSNLLAAGQISGEWVTQLVTVFNVIKDGMLAYLAIFTGINAAKEFGATPGLGGVIGGTTLLTGLTDKNMITNIFTGEPLQPGQGGIIGVIFAVWLLSIIEKRLHKIVPNSIDIIVTPTITLFIIGLLTIFIFMPLAGFVSDGLVTVINGIIDIGGVFSGFIIGAFFLPLVMLGLHHMFTPIHIEMINQTGATYLLPIAAMAGAGQVGAALALWVRCRKNTTLRDTLKGALPVGFLGIGEPLIYGVTLPLGKPFITACIGGGIGGAVIGGIGHIGATAIGPSGISLLPLISDHMYLGYIAGLLVAYAGGFIFTYFFGTTKAMRESDTLGD
Mass
50.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make SSP0594 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here