About Products Protein Database Contact

Protein expression services for Fam192a | PSME3-interacting protein

Description
Promotes the association of the proteasome activator complex subunit PSME3 with the 20S proteasome and regulates its activity. Inhibits PSME3-mediated degradation of some proteasome substrates, probably by affecting their diffusion rate into the catalytic chamber of the proteasome. Also inhibits the interaction of PSME3 with COIL, inhibits accumulation of PSME3 in Cajal bodies and positively regulates the number of Cajal bodies in the nucleus.
Species
Mus musculus
Length
254 amino acids
Sequence
MDGEDDSNLVIKKRFVSEAELDERRKRRQEEWEKVRKPEDPKECPEEAYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELEELKEYRSNLNKVGISAENKEVEKKLAVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPDPDDKAQEAPSCMSLGSSSLSGPPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP
Mass
28.7 kDa
Simulated SDS-PAGE
Western blot of Fam192a recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Fam192a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here