Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor (By similarity).

Belongs to the PINX1 family.

332 amino acids

MSMLAERRRKQKWTVDPRNTAWSNDDSKFGQKMLEKMGWSKGKGLGAQEQGATEHIKVKVKNNHLGLGATNNNEDNWIAHQDDFNQLLAALNTCHGQETADSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSETDLDCIFGKRRNKKLAQDGCSNSSADEVNTSLTTTTTTTSAFTIQEYFAKRMAQLKNKPQASAPGSDLSETPVERKKGKKKNKEAADTDVENSPQHKAKRHKKKKRVEAERGPVAKKRDRAELQPGGPSEDECSDASVEAAEDCVQTPDIQDDVPKPKKRKAKKKLQRPEGVEIDATLDRAPVKKKKKKVSR

37.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Pinx1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here