About Products Protein Database Contact

Protein expression services for pih1d1 | PIH1 domain-containing protein 1

Description
Involved in the assembly of C/D box small nucleolar ribonucleoprotein (snoRNP) particles. Recruits the SWI/SNF complex to the core promoter of rRNA genes and enhances pre-rRNA transcription. Mediates interaction of TELO2 with the R2TP complex which is necessary for the stability of MTOR and SMG1. Positively regulates the assembly and activity of the mTORC1 complex.
Family
Belongs to the PIH1 family.
Species
Danio rerio
Length
287 amino acids
Sequence
MDTDASLLLGVEHEQKQQEELYQQLLLQTMGKLQSDSPPSKVIRPQPGLCVKTSSVSDKKKVFLNICQSQTVPPPPHLSQEALVELLESEDPTSYRVPMSLGEPHTEVDNSSQGCTVYDVVINDEFFQKCEKDTLFQQFLIAVSLEGLENKYSLELSRDIKILKNRKFMGSIAEQNIRTKSKPIIQEIDSKESLTLPSAAKRPEFTLLVEPPSGKAEHLIAEILLPGVSSARSLVLDLGEDRLVLIARPSLFHLDIFFPVLIDQENSVAQYNTNTQTLTVTMPVVSL
Mass
32 kDa
Simulated SDS-PAGE
Western blot of pih1d1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make pih1d1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here