Receptor for ATP and UTP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system.

Belongs to the G-protein coupled receptor 1 family.

single

133 amino acids

ISVHRCLGVLRPLHSLRWGRARYARRVAFAVWVLVLYCQAPVLYFVTTSTRSSRIICHDTSARELFSHFVAYSSVMLSLLFAAPFAVILVCYVLMARRLLKPAYGTSGGLPRAKRKSVRTIAIVLTVFVLCFL

15 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make P2RY2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here