Oxidase; part of the gene cluster that mediates the biosynthesis of fusaric acid, a mycotoxin with low to moderate toxicity to animals and humans, but with high phytotoxic properties (PubMed:25372119). L-aspartate is suggested as fusaric acid amino acid precursor that is activated and further processed to O-acetyl-L-homoserine by cluster enzymes aspartate kinase FUB3 and homoserine O-acetyltransferase FUB5, as well as enzymes of the primary metabolism (By similarity). The polyketide synthase (PKS) FUB1 generates the triketide trans-2-hexenal which is presumptively released by the hydrolase FUB4 and linked to the NRPS-bound amino acid precursor by NAD(P)-dependent dehydrogenase FUB6 (By similarity). FUB1, FUB4, and the non-canonical NRPS Fub8 may form an enzyme complex (By similarity). Further processing of the NRPS-bound intermediate might be carried out by FUB6 and the sulfhydrylase FUB7, enabling a spontaneous electrocyclization to close the carbon backbone of fusaric acid (By similarity). Dihydrofusaric acid is likely to be released via reduction by the thioester reductase (TR) domain of FUB8 whereupon the final oxidation to fusaric acid may (also) be performed by the FMN-dependent dehydrogenase FUB9 (By similarity).

Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family.

387 amino acids

MSRTNLPIQPAKMSDATSSKPQIFSIQDLKQAASDKMSQMYRDYYNGGAMDNITLASNEAAFDRYLLRPRVLRNVSNIDMTTTLWGTKAALPLGVSPSAMHRLAHADGEVGTSKACAARNVPMILSALSNDTLEDVSGQSSDGSTPYAIQVSPFKNRQITTNLLSRAKAAGYKAVVLTVDAPMFGRRLDDLRNGFSIPPGFSFPNLSAQTQSGSGGLGGGIPDLSFDTAATWEEKIAWMKSQTDLEIWVKGVTSPLDAQIAIEQGVDGIIISNHGGRQLDTTPATIDILREIAPIAKGKTRIAIDGGFRRGSDIFKAVALGADFVFVGRIAIWGLAYDGSNGVGLALDLLINEFKLCMGLAGCSKISDITPAHLSILNAKGVLESVY

41.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FUB8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here