High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.

Belongs to the plastid outer envelope porin OEP24 (TC 1.B.28) family.

213 amino acids

MKAALKGKYDLDHNSSGAATVAFNAGDVKLRASITDATFKNSPSLTGLVLAVEKPGSFSVDYNVPKKDFRFQFMNTVRVAEKPLNLAYIHSKGDNRTILDGTLVWDPSNKVSANYAVESGNCKLKYSYNHKGLTTIEPTYDVAKNSWDFAVSGKVYGDDSLKASYQTSSKVLGLEWTRNSKQTGCFKVVASVNLAEEKKIPKLSVESTLNFEM

23.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make OEP24 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here