About Products Protein Database Contact

Protein expression services for OEP161 | Outer envelope pore protein 16-1, chloroplastic

Description
Voltage-dependent high-conductance channel with a slight cation-selectivity; selective for amino acids but excludes triosephosphates or uncharged sugars (By similarity). Non-essential amino acid-selective channel protein and translocation pore for NADPH:protochlorophyllide oxidoreductase A (PORA) and possibly PORB. Involved in PORA precursor (pPORA) import and thus confers photoprotection onto etiolated seedlings during greening.
Family
Belongs to the Tim17/Tim22/Tim23 family. Plastid outer envelope porin OEP16 (TC 1.B.30) subfamily.
Species
Arabidopsis thaliana
Length
148 amino acids
Sequence
MPSSTFSGTVSTPKLSVAVDMGNPFLNLTVDAFLKIGAVGVTKSLAEDTYKAIDKGSLSKSTLEHALKKLCKEGVYWGAAGGVYIGTEYGIERIRGSRDWKNAMLAGAATGAVLSAVGKKGKDTIVIDAILGGALATASQFVNNHYFY
Mass
15.5 kDa
Simulated SDS-PAGE
Western blot of OEP161 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make OEP161 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here