About Products Protein Database Contact

Protein expression services for Odf1 | Outer dense fiber protein 1

Description
Component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail.
Species
Mus musculus
Length
247 amino acids
Sequence
MAALSCLLDSVRRDIKKVDRELRQLRCIDEISSRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDLYYPCCLCDYKLYCLRPSLRSLERLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCNPCNPCSPCSPCAPCACGPCGPCGPCGPCGPCDPCNPCYPCGSRFSCRKMIL
Mass
27.5 kDa
Simulated SDS-PAGE
Western blot of Odf1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Odf1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here