Description
Component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail.
Sequence
MAALSCLLDSVRRDIKKVDRELRQLRCIDEISSRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDLYYPCCLCDYKLYCLRPSLRSLERLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCNPCNPCSPCSPCAPCACGPCGPCGPCGPCGPCDPCNPCYPCGSRFSCRKMIL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service