Part of the OsmU ABC transporter complex, which is involved in the uptake of osmoprotectants such as choline-O-sulfate and glycine betaine.

Belongs to the OsmX family.

300 amino acids

MRFKKHLLGWLAATLLFSSQTQAAPLVLATKSFTEQHILSAMTVQYLQKKGFQVQPQTNIAAVISRNAMVNKQIDITWEYTGTSLIIFNRIDKRMSPQETYDTVKRLDAKLGLVWLKPADMNNTYAFAMQRKRAESENITTISQMVAKIEQVRQNDPDHNWMLGLDLEFAGRSDGMKPLQQAYQMQLDRPQIRQMDPGLVYNAVRDGLVDAGLVYTTDGRVKGFDLKVLEDDKGFFPSYAVTPVVRKEVLEANPGLDDALNTLSGLLNNDVISTLNAQVDIEHRTPQQVAHQFLQDKGLL

33.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make osmX using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here