Protein expression services for oaz1a | Ornithine decarboxylase antizyme 1
Description
Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome.
Family
Belongs to the ODC antizyme family.
Species
Danio rerio
Length
214 amino acids
Sequence
MVKSNLQTILNSHCFVREKESNIPKMPVIELTRNKPESESSHRCSNPCPGPLWCSDVPLPPLKIPGGRGNDQRDHSLSAKLFYSDAQLLVLEEAPQSNSRVRFLLFERRCSVSKHLVWRGALKGTNLYIEIPTGVLPEGSKDSFSLLLEFAEEKLQVDHVFICFHKSRDDRASLLRTFSFMGFEIVRPGHPLVPTRPDAFFMAYRIERDSDGDE
Mass
24.4 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make oaz1a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here