Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity).

Belongs to the ORC4 family.

432 amino acids

MSKRKSKDLCLPVGECISKVHGILRQRLFQHHGKPFGVDSQHKHLVELLKRTVIHGESNSALIIGPRGSGKSMLLKGALEDIFGMKQMKETALQVNLNGLLQTTDKIALKEITRQLHLENVVGDRVFGSFAENLSFLLEALKTGDRKSSCPVLFVLDEFDLFAHHKNQTLLYNLFDIAQSAQTPVAVIGLTCRLDVMELLEKRVKSRFSHRQIHLLNSFSFSQYLQIFQEKLSLPASFPDSQFAEKWNESIKSLVESKLVEDVLQKQYNASKDVRSLHMLMLLAVCRVNVSHPHITAADFLEVFRLRNQDSKANILHGVSVLELCLIIAMKHLQDIYDGEPFNFQMVHNEFQKFIQRKAHSVYNFEKAVVIKAFEHLHQLELIKPMEGLSVRTQKEYRLMKLLLDNTQIVEALQKYPNCPTDVKQWAMSSLS

49.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make orc4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here