Description
Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3 (By similarity).
Family
Belongs to the ORC4 family.
Sequence
MSNRKSKNNIHAECLSQVQRILRERFCHHTPHSNLFGVQVQYKHLIELLKRTAIYGESNSLLIVGPRGSGKTTLLNHALKELMQIGDMSENVLQVHLNGLLQTNDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALQKGNRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAEFPDKIFAEKWNENAHCLSEDSTVLEVLQKHFNVNKNLQSLHMLLMLALNRVTVTHPFMTSADLMEAQHLCSLDAKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFIQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQKYSNCPTDVRQWATSSLSWL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service