About Products Protein Database Contact

Protein expression services for Orc4 | Origin recognition complex subunit 4

Description
Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3 (By similarity).
Family
Belongs to the ORC4 family.
Species
Rattus norvegicus
Length
434 amino acids
Sequence
MSNRKSKNNIHAECLSQVQRILRERFCHHTPHSNLFGVQVQYKHLIELLKRTAIYGESNSLLIVGPRGSGKTTLLNHALKELMQIGDMSENVLQVHLNGLLQTNDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALQKGNRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAEFPDKIFAEKWNENAHCLSEDSTVLEVLQKHFNVNKNLQSLHMLLMLALNRVTVTHPFMTSADLMEAQHLCSLDAKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFIQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQKYSNCPTDVRQWATSSLSWL
Mass
50.1 kDa
Simulated SDS-PAGE
Western blot of Orc4 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Orc4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here