About Products Protein Database Contact

Protein expression services for sirM | O-methyltransferase sirM

Description
O-methyltransferase; part of the gene cluster that mediates the biosynthesis of sirodesmin PL, an epipolythiodioxopiperazine (ETP) characterized by a disulfide bridged cyclic dipeptide and that acts as a phytotoxin which is involved in the blackleg didease of canola (PubMed:15387811, PubMed:18272357, PubMed:19762440). SirD catalyzes the O-prenylation of L-tyrosine (L-Tyr) in the presence of dimethylallyl diphosphate (DMAPP) to yield 4-O-dimethylallyl-L-Tyr, and therefore represents probably the first pathway-specific enzyme in the biosynthesis of sirodesmin PL (PubMed:19762440, PubMed:21038099, PubMed:24083562). 4-O-dimethylallyl-L-Tyr, then undergoes condensation with L-Ser in a reaction catalyzed by the non-ribosomal peptide synthase sirP to form the diketopiperazine (DKP) backbone (PubMed:18272357). Further bishydroxylation of the DKP performed by the cytochrome P450 monooxygenase sirC leads to the production of the intermediate phomamide (PubMed:27390873). This step is essential to form the reactive thiol group required for toxicity of sirodesmin PL (PubMed:27390873). The next steps of sirodesmin biosynthesis are not well understood yet, but some predictions could be made from intermediate compounds identification (PubMed:18272357). Phomamide is converted into phomalizarine via oxidation, probably by sirT (PubMed:18272357). Further oxidation, methylation (by sirM or sirN) and reduction steps convert phomalizarine to deacetyl sirodesmin (PubMed:18272357). Finally, acetyltransferase sirH probably acetylates deacetyl sirodesmin to produce sirodesmin PL (PubMed:18272357).
Family
Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-independent O-methyltransferase family. COMT subfamily.
Species
Leptosphaeria maculans
Length
414 amino acids
Sequence
MDNELDNLISLLQKSKASLKEKHGDRIRSIFAAHHSGSILPKEDKSLYDKCLATVDLLDEVQQMLTPPLHTLIDGFFGFINSKTLLCAVEFGIPDALSQGPKSIEQLASSSPQGELSPHRLTQVLRTLTGIGIFNYDKTSKLYSNNATSDLITTAHWSKWVYWTKFYPTEFYDMMRFLPDHIKANASRTAAQSNYNTDMEFYEYLSNSGLAKEFHRVLGAGATAQLPGMISDFPWDTLGDETVLDLGTGSGEFLFQLLENYPRMRGAFMDIPSTISRIQAECEQPGGRFSGVRDRVAGFHAGNFLDEVPASVVYTIKWCLHNWSDEDTIKILQNIRRAIVVKPEARLLIIESVLEDGRTGRPARYGDIIMMATCNGKERDIENWQAVCEQSGWEVVKSWALRNSIPSCLELRPI
Mass
46.6 kDa
Simulated SDS-PAGE
Western blot of sirM recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make sirM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here