About Products Protein Database Contact

Protein expression services for af390-400 | O-methyltransferase af390-400

Description
O-methyltransferase; part of the gene cluster that mediates the biosynthesis of fumagillin, a meroterpenoid that has numerous biological activities including irreversible inhibition of human type 2 methionine aminopeptidase (METAP2) (PubMed:23488861, PubMed:24568283). The pathway begins with the conversion of farnesyl pyrophosphate (FPP) to beta-trans-bergamotene by the membrane-bound beta-trans-bergamotene synthase af520 (PubMed:23488861). The initial oxidation of beta-trans-bergamotene by the multifunctional cytochrome P450 monooxygenase af510 involves C-H hydroxylation at the bridgehead C5 position to yield 5R-hydroxyl-beta-trans-bergamotene (PubMed:24568283). Subsequently, a four electron oxidation initiated at C-9 coupled to cleavage of the cyclobutane C5-C8 bond of the bicyclo[3.1.1] core yields the epoxyketone intermediate 5-keto-cordycol (PubMed:24568283). An additional epoxidation reaction also catalyzed by af510 then furnishes the characteristic bisepoxide ketone 5-keto-demethoxyfumagillol (PubMed:24568283). 5-keto-demethoxyfumagillol is then subjected to successive C-6 hydroxylation and O-methylation by the dioxygenase af480 and O-methyltransferase af390-400, respectively, to yield 5-keto-fumagillol, which is then stereoselectively reduced by the keto-reductase af490 to 5R-hydroxy-seco-sesquiterpene (PubMed:24568283). The next step is the polyketide transferase af380-catalyzed transfer of a dodecapentaenoyl group synthesized by the polyketide synthase af370 onto 5R-hydroxy-seco-sesquiterpene which leads to the production of prefumagillin (PubMed:24568283). Finally, oxidative cleavage by the monooxygenase af470 converts prefumagillin to fumagillin (PubMed:24568283).
Family
Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-independent O-methyltransferase family. COMT subfamily.
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100)
Length
400 amino acids
Sequence
MADIAEQLIEKLQTLETSIFEGQDATRQKLALAARKLFHTLETKEEKTMRLAIEEPVMFSVLQALIDTGLFEGWAAAGGGERDVTELAKLSKRDVEPELLRHQLRLMAANHIILETANDRYAPTPYALAIGDKSTKVAPALRIRTDHVAPCAMHWPDFLAKTNYRKPRDDKASCYIDTFPEKKSFFERCSANPVHQESFSSFMDVWAKGKRPWPEFYDTQALLDGADLSNGSPFVVDVGGHHGIDLMRVAEKHPDLPAGSLVLEDLPDVVGAVHLTTDKIRTVAHDLFEEGVEQPIKGARAYFMHAVLHDWSDETSVKILRQIAAVMKPGYSKVLINDIVIPSTGASCYQAAMDCLVLQASANERTEAVWSKVIKDAGLKLVKYYPDGRGYESVIEAELP
Mass
44.5 kDa
Simulated SDS-PAGE
Western blot of af390-400 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make af390-400 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here