Protein expression services for fat-1 | Omega-3 fatty acid desaturase fat-1
Description
Omega-3 fatty acid desaturase that acts on a range of substrates. Catalyzes the desaturation of linolenic acid (18:2n-6), dihomo-gamma-linoleic acid (DHGLA) (20:3n-6), and arachidonic acid (20:4n-6), to generate gamma linolenic acid (18:3n-3), eicosatetraenoic acid (20:4n-3) and eicosapentaenoic acid (20:5n-3) respectively. Although the enzyme has been suggested to act on glycerolipids, the precise nature of the fatty acid substrate is unknown.
Family
Belongs to the fatty acid desaturase type 1 family.
Species
Caenorhabditis elegans
Length
402 amino acids
Sequence
MVAHSSEGLSATAPVTGGDVLVDARASLEEKEAPRDVNANTKQATTEEPRIQLPTVDAFRRAIPAHCFERDLVKSIRYLVQDFAALTILYFALPAFEYFGLFGYLVWNIFMGVFGFALFVVGHDCLHGSFSDNQNLNDFIGHIAFSPLFSPYFPWQKSHKLHHAFTNHIDKDHGHVWIQDKDWEAMPSWKRWFNPIPFSGWLKWFPVYTLFGFCDGSHFWPYSSLFVRNSERVQCVISGICCCVCAYIALTIAGSYSNWFWYYWVPLSFFGLMLVIVTYLQHVDDVAEVYEADEWSFVRGQTQTIDRYYGLGLDTTMHHITDGHVAHHFFNKIPHYHLIEATEGVKKVLEPLSDTQYGYKSQVNYDFFARFLWFNYKLDYLVHKTAGIMQFRTTLEEKAKAK
Mass
46.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make fat-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here